PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00139176001
Common NameGSBRNA2T00139176001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family RAV
Protein Properties Length: 325aa    MW: 36594.3 Da    PI: 9.7117
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00139176001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP240.66.3e-1364112155
                  AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                          s++kGV   + +grW A+I++      ++r++lg+f  ++eAa+a++ a+ +++g
  GSBRNA2T00139176001  64 SRFKGVVPQP-NGRWGAQIYEK-----HQRVWLGTFNEEDEAARAYDVAAHRFRG 112
                          689***9788.8*********3.....5**********99************998 PP

2B367.81.5e-212022663397
                          -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                           + l +ed +g++W+++++y+++s++yvltkGW++Fvk+++L++gD + Fk+++ ++++l++++ 
  GSBRNA2T00139176001 202 LTLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKRLCAGDLISFKRSNGQDQQLYIGWK 266
                          567899*********************************************98778888999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008472.8E-864112IPR001471AP2/ERF domain
SuperFamilySSF541713.99E-1764121IPR016177DNA-binding domain
CDDcd000183.41E-2564122No hitNo description
PROSITE profilePS5103220.08665120IPR001471AP2/ERF domain
SMARTSM003801.9E-2765126IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.104.7E-2065120IPR001471AP2/ERF domain
CDDcd100173.64E-15188256No hitNo description
SuperFamilySSF1019362.22E-19189273IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.2E-9189269IPR003340B3 DNA binding domain
PROSITE profilePS5086311.279202267IPR003340B3 DNA binding domain
PfamPF023622.8E-18203267IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-23205272IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDAASSVDES STSTDSVHTP AKIPPATARK SSSPASLYRM GSGSSVVLDS ENGVEAESRK  60
LPSSRFKGVV PQPNGRWGAQ IYEKHQRVWL GTFNEEDEAA RAYDVAAHRF RGRDAVTNFK  120
ADTTLDNGDE IEFLNAHSKA EIVDMLRKHT YREELEQMKR NLHGKGNTKE TAFAAVRIAT  180
GFKTAETLFE KAVTPRDVSV RLTLLNFEDV NGKVWRFRYS YWNSSQSYVL TKGWSRFVKE  240
KRLCAGDLIS FKRSNGQDQQ LYIGWKSKCE SDQDTGRVVV RLFGVDITSL KSQNDLVMKE  300
ETEMLSLRCN KKQRLLVIKM GLFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-4318527510124DNA-binding protein RAV1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.218560.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00139176001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599419.10.0PREDICTED: AP2/ERF and B3 domain-containing transcription factor ARF14
SwissprotQ9LS061e-158RAVL4_ARATH; AP2/ERF and B3 domain-containing transcription factor ARF14
TrEMBLA0A078D3590.0A0A078D359_BRANA; BnaC07g22870D protein
STRINGBra025159.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84827121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25730.11e-151ethylene response DNA binding factor 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]